-
- Target See all SOD2 Antibodies
- SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SOD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SOD2 antibody was raised against the N terminal of SOD2
- Purification
- Affinity purified
- Immunogen
- SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH
- Top Product
- Discover our top product SOD2 Primary Antibody
-
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) (AA 25-222) antibody
SOD2 Reactivity: Human WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) (AA 25-222) antibodySOD2 Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) (AA 1-222) antibodySOD2 Reactivity: Human IHC, ELISA, ICC, FACS Host: Mouse Monoclonal 8H3D2 unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) (AA 1-222) antibodySOD2 Reactivity: Human WB, IHC, ELISA, FACS Host: Mouse Monoclonal 8H3F9 unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) antibodySOD2 Reactivity: Rat WB, IHC, ELISA, IP, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) (AA 25-222) antibodySOD2 Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) (AA 64-175) antibodySOD2 Reactivity: Human WB, IHC, ELISA, IP, IF Host: Rabbit Polyclonal unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) (AA 41-78) antibodySOD2 Reactivity: Human, Mouse, Pig, Sheep WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) (AA 119-130) antibodyVerified SOD2 Reactivity: Human, Rat, Mouse, Pig WB, IHC, ELISA Host: Goat Polyclonal unconjugated
anti-Superoxide Dismutase 2, Mitochondrial (SOD2) antibody (Alkaline Phosphatase (AP))SOD2 Reactivity: Rat WB, IHC, ELISA, IP, IF, ICC Host: Rabbit Polyclonal Alkaline Phosphatase (AP)
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SOD2 Blocking Peptide, catalog no. 33R-6219, is also available for use as a blocking control in assays to test for specificity of this SOD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))
- Alternative Name
- SOD2 (SOD2 Products)
- Background
- SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling
-
You are here:
