SOD2 antibody (N-Term)

Catalog No. ABIN634322

The Rabbit Polyclonal anti-SOD2 antibody has been validated for WB. It is suitable to detect SOD2 in samples from Human.

Quick Overview for SOD2 antibody (N-Term) (ABIN634322)

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SOD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SOD2 Antibody

Binding Specificity: N-Term

Specificity: SOD2 antibody was raised against the N terminal of SOD2

Purification: Affinity purified

Immunogen: SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SOD2 Blocking Peptide, (ABIN5616335), is also available for use as a blocking control in assays to test for specificity of this SOD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SOD2

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Alternative Name: SOD2

Background: SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling