RHOC antibody (N-Term)

Catalog No. ABIN634331

The Rabbit Polyclonal anti-RHOC antibody has been validated for WB. It is suitable to detect RHOC in samples from Human, Mouse, Rat, Dog, Drosophila melanogaster and C. elegans.

Quick Overview for RHOC antibody (N-Term) (ABIN634331)

Target: RHOC (Ras Homolog Gene Family, Member C (RHOC))

Reactivity: Human, Mouse, Rat, Dog, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHOC antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RHOC Antibody

Binding Specificity: N-Term

Specificity: RHOC antibody was raised against the N terminal of RHOC

Purification: Affinity purified

Immunogen: RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHOC Blocking Peptide, (ABIN5615860), is also available for use as a blocking control in assays to test for specificity of this RHOC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHOC

Target: RHOC (Ras Homolog Gene Family, Member C (RHOC))

Alternative Name: RHOC

Background: RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: WNT Signaling, Cell-Cell Junction Organization