FYN antibody (N-Term)

Catalog No. ABIN634345

This Rabbit Polyclonal antibody specifically detects FYN in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FYN antibody (N-Term) (ABIN634345)

Target: FYN (FYN Oncogene Related To SRC, FGR, YES (FYN))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FYN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FYN Antibody

Binding Specificity: N-Term

Specificity: FYN antibody was raised against the N terminal of FYN

Purification: Affinity purified

Immunogen: FYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FYN Blocking Peptide, (ABIN938579), is also available for use as a blocking control in assays to test for specificity of this FYN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FYN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FYN

Target: FYN (FYN Oncogene Related To SRC, FGR, YES (FYN))

Alternative Name: FYN

Background: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Activated T Cell Proliferation, Thromboxane A2 Receptor Signaling