IFIT5 antibody (Middle Region)

Catalog No. ABIN634393

This Rabbit Polyclonal antibody specifically detects IFIT5 in WB. It exhibits reactivity toward Human.

Quick Overview for IFIT5 antibody (Middle Region) (ABIN634393)

Target: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFIT5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IFIT5 Antibody

Binding Specificity: Middle Region

Specificity: IFIT5 antibody was raised against the middle region of IFIT5

Purification: Affinity purified

Immunogen: IFIT5 antibody was raised using the middle region of IFIT5 corresponding to a region with amino acids ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFIT5 Blocking Peptide, (ABIN939578), is also available for use as a blocking control in assays to test for specificity of this IFIT5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFIT5

Target: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Alternative Name: IFIT5

Background: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Molecular Weight: 56 kDa (MW of target protein)