ADA antibody (N-Term)

Catalog No. ABIN634435

Product Details anti-ADA Antibody

Target: ADA (Adenosine Deaminase (ADA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADA antibody was raised against the N terminal of ADA

Purification: Affinity purified

Immunogen: ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADA Blocking Peptide, catalog no. 33R-1257, is also available for use as a blocking control in assays to test for specificity of this ADA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADA

Target: ADA (Adenosine Deaminase (ADA))

Alternative Name: ADA (ADA Products)

Synonyms: ADA-like antibody, xada antibody, ADA antibody, CG11994 antibody, Dmel\\CG11994 antibody, DrosADA antibody, dADA antibody, zgc:92028 antibody, adenosine deaminase antibody, adenosine deaminase S homeolog antibody, Adenosine deaminase antibody, ADA antibody, Ada antibody, ada.S antibody, ada antibody

Background: ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Ribonucleoside Biosynthetic Process