VPREB1 antibody (Middle Region)

Catalog No. ABIN634478

Product Details anti-VPREB1 Antibody

Target: VPREB1 (Pre-B Lymphocyte 1 (VPREB1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPREB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VPREB1 antibody was raised against the middle region of VPREB1

Purification: Affinity purified

Immunogen: VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPREB1 Blocking Peptide, catalog no. 33R-9127, is also available for use as a blocking control in assays to test for specificity of this VPREB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPREB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPREB1

Target: VPREB1 (Pre-B Lymphocyte 1 (VPREB1))

Alternative Name: VPREB1 (VPREB1 Products)

Synonyms: IGI antibody, IGVPB antibody, VPREB antibody, VpreB antibody, CD179a antibody, Vpreb-1 antibody, V-set pre-B cell surrogate light chain 1 antibody, immunoglobulin iota chain antibody, immunoglobulin iota chain-like antibody, pre-B lymphocyte 1 antibody, pre-B lymphocyte gene 1 antibody, VPREB1 antibody, LOC698810 antibody, LOC486411 antibody, Vpreb1 antibody

Background: VPREB1 belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Regulation of Cell Size