LBP antibody (C-Term)

Catalog No. ABIN634479

This anti-LBP antibody is a Rabbit Polyclonal antibody detecting LBP in WB. Suitable for Human.

Quick Overview for LBP antibody (C-Term) (ABIN634479)

Target: LBP (Lipopolysaccharide Binding Protein (LBP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LBP Antibody

Binding Specificity: C-Term

Specificity: LBP antibody was raised against the C terminal of LBP

Purification: Affinity purified

Immunogen: LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LBP Blocking Peptide, (ABIN938351), is also available for use as a blocking control in assays to test for specificity of this LBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LBP

Target: LBP (Lipopolysaccharide Binding Protein (LBP))

Alternative Name: LBP

Background: LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Toll-Like Receptors Cascades, Monocarboxylic Acid Catabolic Process