LBP antibody (C-Term)
-
- Target See all LBP Antibodies
- LBP (Lipopolysaccharide Binding Protein (LBP))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LBP antibody was raised against the C terminal of LBP
- Purification
- Affinity purified
- Immunogen
- LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL
- Top Product
- Discover our top product LBP Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LBP Blocking Peptide, catalog no. 33R-2965, is also available for use as a blocking control in assays to test for specificity of this LBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LBP (Lipopolysaccharide Binding Protein (LBP))
- Alternative Name
- LBP (LBP Products)
- Synonyms
- BPIFD2 antibody, Bpifd2 antibody, Ly88 antibody, LPSBP antibody, LBP antibody, lipopolysaccharide binding protein antibody, lipopolysaccharide-binding protein antibody, LBP antibody, Lbp antibody, LOC100472839 antibody
- Background
- LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Toll-Like Receptors Cascades, Monocarboxylic Acid Catabolic Process
-