Complement C2 antibody (N-Term)

Catalog No. ABIN634491

Product Details anti-Complement C2 Antibody

Target: Complement C2

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Complement C2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Complement C2 antibody was raised against the N terminal of C2

Purification: Affinity purified

Immunogen: Complement C2 antibody was raised using the N terminal of C2 corresponding to a region with amino acids EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Complement C2 Blocking Peptide, catalog no. 33R-2634, is also available for use as a blocking control in assays to test for specificity of this Complement C2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Complement C2

Target: Complement C2

Abstract: Complement C2 Products

Synonyms: CO2 antibody, complement C2 antibody, complement component 2 (within H-2S) antibody, C2 antibody

Background: Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.

Molecular Weight: 81 kDa (MW of target protein)