PRKAA1 antibody (N-Term)

Catalog No. ABIN634502

The Rabbit Polyclonal anti-PRKAA1 antibody is suitable to detect PRKAA1 in samples from Human. It has been validated for WB.

Quick Overview for PRKAA1 antibody (N-Term) (ABIN634502)

Target: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKAA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRKAA1 Antibody

Binding Specificity: N-Term

Specificity: PRKAA1 antibody was raised against the N terminal of PRKAA1

Purification: Affinity purified

Immunogen: PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKAA1 Blocking Peptide, (ABIN938621), is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKAA1

Target: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Alternative Name: PRKAA1

Background: PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effect