GADD45B antibody (Middle Region)
Quick Overview for GADD45B antibody (Middle Region) (ABIN634503)
Target
See all GADD45B AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- Middle Region
-
Specificity
- GADD45 B antibody was raised against the middle region of GADD45
-
Purification
- Affinity purified
-
Immunogen
- GADD45 B antibody was raised using the middle region of GADD45 corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
-
-
-
-
Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
GADD45B Blocking Peptide, (ABIN938237), is also available for use as a blocking control in assays to test for specificity of this GADD45B antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GADD40 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))
-
Alternative Name
- GADD45B
-
Background
- GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.
-
Molecular Weight
- 18 kDa (MW of target protein)
-
Pathways
- Cell Division Cycle
Target
-