GADD45B antibody (Middle Region)

Catalog No. ABIN634503

This anti-GADD45B antibody is a Rabbit Polyclonal antibody detecting GADD45B in WB. Suitable for Human, Mouse and Rat.

Quick Overview for GADD45B antibody (Middle Region) (ABIN634503)

Target: GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GADD45B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GADD45B Antibody

Binding Specificity: Middle Region

Specificity: GADD45 B antibody was raised against the middle region of GADD45

Purification: Affinity purified

Immunogen: GADD45 B antibody was raised using the middle region of GADD45 corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GADD45B Blocking Peptide, (ABIN938237), is also available for use as a blocking control in assays to test for specificity of this GADD45B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GADD40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GADD45B

Target: GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))

Alternative Name: GADD45B

Background: GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: Cell Division Cycle