LGALS1/Galectin 1 antibody

Catalog No. ABIN634507

Product Details anti-LGALS1/Galectin 1 Antibody

Target: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LGALS1/Galectin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LGALS1 Blocking Peptide, catalog no. 33R-2676, is also available for use as a blocking control in assays to test for specificity of this LGALS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LGALS1/Galectin 1

Target: LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))

Alternative Name: LGALS1 (LGALS1 Products)

Synonyms: GAL1 antibody, GBP antibody, Galectin-1 antibody, LGAS1 antibody, LGALS1 antibody, MGC64502 antibody, GB10026 antibody, AA410090 antibody, Gal-1 antibody, Galbp antibody, L-14.5 antibody, L14 antibody, Lect14 antibody, galectin-1 antibody, Galaptin antibody, galectin 1 antibody, galectin-1 antibody, lectin, galactoside-binding, soluble, 1 L homeolog antibody, protein enabled antibody, lectin, galactose binding, soluble 1 antibody, LGALS1 antibody, Lgals1 antibody, CC1G_05003 antibody, CC1G_05004 antibody, lgals1.L antibody, LOC408848 antibody

Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis