Beclin 1 antibody (N-Term)

Catalog No. ABIN634508

The Rabbit Polyclonal anti-Beclin 1 antibody is suitable to detect Beclin 1 in samples from Human. It has been validated for WB.

Quick Overview for Beclin 1 antibody (N-Term) (ABIN634508)

Target: Beclin 1 (BECN1) (Beclin 1, Autophagy Related (BECN1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Beclin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Beclin 1 Antibody

Binding Specificity: N-Term

Specificity: BECN1 antibody was raised against the N terminal of BECN1

Purification: Affinity purified

Immunogen: BECN1 antibody was raised using the N terminal of BECN1 corresponding to a region with amino acids MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BECN1 Blocking Peptide, (ABIN5612311), is also available for use as a blocking control in assays to test for specificity of this BECN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BECN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Beclin 1

Target: Beclin 1 (BECN1) (Beclin 1, Autophagy Related (BECN1))

Alternative Name: BECN1

Background: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Autophagy