Angiotensin II Type-1 Receptor antibody (N-Term)

Catalog No. ABIN634511

The Rabbit Polyclonal anti-Angiotensin II Type-1 Receptor antibody is suitable to detect Angiotensin II Type-1 Receptor in samples from Human, Rat, Mouse and Dog. It has been validated for WB.

Quick Overview for Angiotensin II Type-1 Receptor antibody (N-Term) (ABIN634511)

Target: Angiotensin II Type-1 Receptor (AGTR1) (Angiotensin II Receptor, Type 1 (AGTR1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Angiotensin II Type-1 Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Angiotensin II Type-1 Receptor Antibody

Binding Specificity: N-Term

Specificity: AGTR1 antibody was raised against the N terminal of AGTR1

Purification: Affinity purified

Immunogen: AGTR1 antibody was raised using the N terminal of AGTR1 corresponding to a region with amino acids ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGTR1 Blocking Peptide, (ABIN939442), is also available for use as a blocking control in assays to test for specificity of this AGTR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGTR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Angiotensin II Type-1 Receptor

Target: Angiotensin II Type-1 Receptor (AGTR1) (Angiotensin II Receptor, Type 1 (AGTR1))

Alternative Name: AGTR1

Background: Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. AGTR1 is the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, ACE Inhibitor Pathway, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour