CHST15 antibody (Middle Region)
-
- Target See all CHST15 Antibodies
- CHST15 (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHST15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GALNAC4 S-4 T antibody was raised against the middle region of GALNAC4 -4 T
- Purification
- Affinity purified
- Immunogen
- GALNAC4 S-4 T antibody was raised using the middle region of GALNAC4 -4 T corresponding to a region with amino acids YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
- Top Product
- Discover our top product CHST15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GALNAC4S-6ST Blocking Peptide, catalog no. 33R-10074, is also available for use as a blocking control in assays to test for specificity of this GALNAC4S-6ST antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNAC0 -0 T antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST15 (Carbohydrate (N-Acetylgalactosamine 4-Sulfate 6-O) Sulfotransferase 15 (CHST15))
- Alternative Name
- GALNAC4S-6ST (CHST15 Products)
- Synonyms
- GALNAC4S-6ST antibody, BRAG antibody, RP11-47G11.1 antibody, 4631426J05Rik antibody, GalNAcS-6ST antibody, MAd5 antibody, mKIAA0598 antibody, GalNAc4S6ST antibody, Galnac4s-6st antibody, carbohydrate sulfotransferase 15 antibody, carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15 antibody, CHST15 antibody, chst15 antibody, Chst15 antibody
- Background
- GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression, however such results are unclear in vivo.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-