KLRF1 antibody (Middle Region)

Catalog No. ABIN634539

The Rabbit Polyclonal anti-KLRF1 antibody (ABIN634539) specifically detects KLRF1 in WB. The antibody is reactive with Human samples.

Quick Overview for KLRF1 antibody (Middle Region) (ABIN634539)

Target: KLRF1 (Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLRF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KLRF1 Antibody

Binding Specificity: Middle Region

Specificity: KLRF1 antibody was raised against the middle region of KLRF1

Purification: Affinity purified

Immunogen: KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLRF1 Blocking Peptide, (ABIN5614395), is also available for use as a blocking control in assays to test for specificity of this KLRF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLRF1

Target: KLRF1 (Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1))

Alternative Name: KLRF1

Background: KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release.

Molecular Weight: 26 kDa (MW of target protein)