CCR2 antibody

Catalog No. ABIN634540

Product Details anti-CCR2 Antibody

Target: CCR2 (Chemokine (C-C Motif) Receptor 2 (CCR2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCR2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CCR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCR2 Blocking Peptide, catalog no. 33R-5054, is also available for use as a blocking control in assays to test for specificity of this CCR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCR2

Target: CCR2 (Chemokine (C-C Motif) Receptor 2 (CCR2))

Alternative Name: CCR2 (CCR2 Products)

Background: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process