EPOR antibody (N-Term)

Catalog No. ABIN634567

This Rabbit Polyclonal antibody specifically detects EPOR in WB. It exhibits reactivity toward Human and Dog.

Quick Overview for EPOR antibody (N-Term) (ABIN634567)

Target: EPOR (Erythropoietin Receptor (EPOR))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPOR antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EPOR Antibody

Binding Specificity: N-Term

Specificity: EPOr antibody was raised against the N terminal of EPOR

Purification: Affinity purified

Immunogen: EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPOr Blocking Peptide, (ABIN937364), is also available for use as a blocking control in assays to test for specificity of this EPOr antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPOR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPOR

Target: EPOR (Erythropoietin Receptor (EPOR))

Alternative Name: EPOr

Background: The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: JAK-STAT Signaling