EPOR antibody (N-Term)
-
- Target See all EPOR Antibodies
- EPOR (Erythropoietin Receptor (EPOR))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EPOR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EPOr antibody was raised against the N terminal of EPOR
- Purification
- Affinity purified
- Immunogen
- EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL
- Top Product
- Discover our top product EPOR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EPOr Blocking Peptide, catalog no. 33R-1978, is also available for use as a blocking control in assays to test for specificity of this EPOr antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPOR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPOR (Erythropoietin Receptor (EPOR))
- Alternative Name
- EPOr (EPOR Products)
- Synonyms
- EPOR antibody, epor antibody, EPO-R antibody, erythropoietin receptor antibody, erythropoietin receptor L homeolog antibody, EPOR antibody, epor antibody, Epor antibody, epor.L antibody
- Background
- The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling
-