ATP6V0A2 antibody (N-Term)

Catalog No. ABIN634572

This anti-ATP6V0A2 antibody is a Rabbit Polyclonal antibody detecting ATP6V0A2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ATP6V0A2 antibody (N-Term) (ABIN634572)

Target: ATP6V0A2 (ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP6V0A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATP6V0A2 Antibody

Binding Specificity: N-Term

Specificity: ATP6 V6 2 antibody was raised against the N terminal of ATP6 6 2

Purification: Affinity purified

Immunogen: ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP6V0A2 Blocking Peptide, (ABIN939466), is also available for use as a blocking control in assays to test for specificity of this ATP6V0A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP6V0A2

Target: ATP6V0A2 (ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2))

Alternative Name: ATP6V0A2

Background: The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells.

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport