MAPT antibody (Middle Region)

Catalog No. ABIN634593

Product Details anti-MAPT Antibody

Target: MAPT (Microtubule-Associated Protein tau (MAPT))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAPT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAPT antibody was raised against the middle region of MAPT

Purification: Affinity purified

Immunogen: MAPT antibody was raised using the middle region of MAPT corresponding to a region with amino acids NAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLAD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAPT Blocking Peptide, catalog no. 33R-6638, is also available for use as a blocking control in assays to test for specificity of this MAPT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAPT

Target: MAPT (Microtubule-Associated Protein tau (MAPT))

Alternative Name: MAPT (MAPT Products)

Synonyms: DDPAC antibody, FTDP-17 antibody, MAPTL antibody, MSTD antibody, MTBT1 antibody, MTBT2 antibody, PPND antibody, TAU antibody, AI413597 antibody, AW045860 antibody, Mtapt antibody, Tau antibody, RNPTAU antibody, pTau antibody, tau antibody, xtp antibody, MAPT antibody, PHF-tau antibody, slc6a6 antibody, taut antibody, wu:fc26e12 antibody, microtubule associated protein tau antibody, microtubule-associated protein tau antibody, microtubule associated protein tau S homeolog antibody, Microtubule-associated protein tau antibody, solute carrier family 6 (neurotransmitter transporter), member 6b antibody, MAPT antibody, Mapt antibody, mapt.S antibody, LOC5580230 antibody, CpipJ_CPIJ013260 antibody, tau antibody, slc6a6b antibody

Background: MAPT is differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. The mutations in the gene have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: MAPK Signaling, Microtubule Dynamics, M Phase, Regulation of Cell Size