TUBB antibody (N-Term)

Catalog No. ABIN634598

The Rabbit Polyclonal anti-TUBB antibody has been validated for WB. It is suitable to detect TUBB in samples from Human, Mouse and Rat.

Quick Overview for TUBB antibody (N-Term) (ABIN634598)

Target: TUBB (Tubulin, beta (TUBB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TUBB Antibody

Binding Specificity: N-Term

Specificity: Beta Tubulin antibody was raised against the N terminal of TUBB

Purification: Affinity purified

Immunogen: Beta Tubulin antibody was raised using the N terminal of TUBB corresponding to a region with amino acids YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Tubulin Blocking Peptide, (ABIN936086), is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBB

Target: TUBB (Tubulin, beta (TUBB))

Alternative Name: beta Tubulin

Background: TUBB belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics, M Phase