Transglutaminase 2 antibody

Catalog No. ABIN634623

The Rabbit Polyclonal anti-Transglutaminase 2 antibody (ABIN634623) specifically detects Transglutaminase 2 in WB. The antibody is reactive with Human samples.

Quick Overview for Transglutaminase 2 antibody (ABIN634623)

Target: Transglutaminase 2 (TGM2) (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Transglutaminase 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Transglutaminase 2 Antibody

Purification: Affinity purified

Immunogen: Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Transglutaminase 2 Blocking Peptide, (ABIN5616757), is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Transglutaminase 2

Target: Transglutaminase 2 (TGM2) (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM2))

Alternative Name: Transglutaminase 2

Background: Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. TGM2 acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis.

Molecular Weight: 77 kDa (MW of target protein)

Pathways: Tube Formation, Thromboxane A2 Receptor Signaling