Fibronectin 1 antibody (N-Term)
-
- Target See all Fibronectin 1 (FN1) Antibodies
- Fibronectin 1 (FN1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Fibronectin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Fibronectin 1 antibody was raised against the N terminal of FN1
- Purification
- Affinity purified
- Immunogen
- Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
- Top Product
- Discover our top product FN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Fibronectin 1 Blocking Peptide, catalog no. 33R-3443, is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fibronectin 1 (FN1)
- Alternative Name
- Fibronectin 1 (FN1 Products)
- Synonyms
- FN1 antibody, FN antibody, cig antibody, fibronectin antibody, finc antibody, lets antibody, msf antibody, Fn antibody, fn2 antibody, fb80d10 antibody, wu:fb80d10 antibody, CIG antibody, ED-B antibody, FINC antibody, FNZ antibody, GFND antibody, GFND2 antibody, LETS antibody, MSF antibody, E330027I09 antibody, Fn-1 antibody, FIBNEC antibody, fn-1 antibody, fibronectin 1 antibody, fibronectin 1a antibody, fibronectin 1 S homeolog antibody, FN1 antibody, fn1 antibody, fn1a antibody, Fn1 antibody, fn1.S antibody
- Background
- FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis and wound healing.
- Molecular Weight
- 71 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy
-