DLL1 antibody

Catalog No. ABIN634696

Product Details anti-DLL1 Antibody

Target: DLL1 (delta-Like 1 (DLL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLL1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLL1 Blocking Peptide, catalog no. 33R-3580, is also available for use as a blocking control in assays to test for specificity of this DLL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLL1

Target: DLL1 (delta-Like 1 (DLL1))

Alternative Name: DLL1 (DLL1 Products)

Synonyms: X-delta-1 antibody, XDelta1 antibody, Xdelta-1 antibody, delta antibody, delta-1 antibody, delta1 antibody, x-delta antibody, DELTA1 antibody, DL1 antibody, Delta antibody, DLK antibody, DLK-1 antibody, Delta1 antibody, FA1 antibody, PREF1 antibody, Pref-1 antibody, ZOG antibody, pG2 antibody, DLL1 antibody, AW742678 antibody, DlkI antibody, Ly107 antibody, Peg9 antibody, SCP1 antibody, pref-1 antibody, delta-like 1 antibody, delta like canonical Notch ligand 1 antibody, delta like non-canonical Notch ligand 1 antibody, delta-like 1 L homeolog antibody, delta-like 1 (Drosophila) antibody, delta-like 1 homolog (Drosophila) antibody, dll1 antibody, DLL1 antibody, DLK1 antibody, Dll1 antibody, dll1.L antibody, Dlk1 antibody

Background: DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.

Molecular Weight: 78 kDa (MW of target protein)

Pathways: Notch Signaling, Stem Cell Maintenance