Desmocollin 3 antibody (N-Term)

Catalog No. ABIN634705

Product Details anti-Desmocollin 3 Antibody

Target: Desmocollin 3 (DSC3)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Desmocollin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Desmocollin 3 antibody was raised against the N terminal of DSC3

Purification: Affinity purified

Immunogen: Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Desmocollin 3 Blocking Peptide, catalog no. 33R-6324, is also available for use as a blocking control in assays to test for specificity of this Desmocollin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Desmocollin 3

Target: Desmocollin 3 (DSC3)

Alternative Name: Desmocollin 3 (DSC3 Products)

Synonyms: CDHF3 antibody, DSC antibody, DSC1 antibody, DSC2 antibody, DSC4 antibody, HT-CP antibody, 5430426I24Rik antibody, MGC85083 antibody, desmocollin 3 antibody, desmocollin 3 S homeolog antibody, DSC3 antibody, Dsc3 antibody, dsc3.S antibody, dsc3 antibody

Background: DSC3 is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation.

Molecular Weight: 85 kDa (MW of target protein)