Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) antibody

Catalog No. ABIN634712

The Rabbit Polyclonal anti- antibody has been validated for WB. It is suitable to detect in samples from Human, Mouse and Rat.

Quick Overview for Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) antibody (ABIN634712)

Target: Protocadherin gamma Subfamily A, 4 (PCDHGA4)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: PCDHGA4 antibody was raised against the N terminal of PCDHGA4

Purification: Affinity purified

Immunogen: PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHGA4 Blocking Peptide, (ABIN938591), is also available for use as a blocking control in assays to test for specificity of this PCDHGA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Protocadherin gamma Subfamily A, 4 (PCDHGA4)

Alternative Name: PCDHGA4

Background: PCDHGA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molecular Weight: 86 kDa (MW of target protein)