SIGLEC7 antibody (Middle Region)
-
- Target See all SIGLEC7 Antibodies
- SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SIGLEC7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SIGLEC7 antibody was raised against the middle region of SIGLEC7
- Purification
- Affinity purified
- Immunogen
- SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL
- Top Product
- Discover our top product SIGLEC7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SIGLEC7 Blocking Peptide, catalog no. 33R-10031, is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))
- Alternative Name
- SIGLEC7 (SIGLEC7 Products)
- Background
- SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.
- Molecular Weight
- 51 kDa (MW of target protein)
-