SIGLEC7 antibody (Middle Region)

Catalog No. ABIN634724

Product Details anti-SIGLEC7 Antibody

Target: SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIGLEC7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SIGLEC7 antibody was raised against the middle region of SIGLEC7

Purification: Affinity purified

Immunogen: SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIGLEC7 Blocking Peptide, catalog no. 33R-10007, is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIGLEC7

Target: SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))

Alternative Name: SIGLEC7 (SIGLEC7 Products)

Synonyms: SIGLEC7 antibody, AIRM1 antibody, CD328 antibody, CDw328 antibody, D-siglec antibody, QA79 antibody, SIGLEC-7 antibody, SIGLEC19P antibody, SIGLECP2 antibody, p75 antibody, p75/AIRM1 antibody, sialic acid-binding Ig-like lectin 7 antibody, sialic acid binding Ig like lectin 7 antibody, LOC468976 antibody, SIGLEC7 antibody

Background: SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

Molecular Weight: 51 kDa (MW of target protein)