VGF antibody (Middle Region)

Catalog No. ABIN634791

Product Details anti-VGF Antibody

Target: VGF (VGF Nerve Growth Factor Inducible (VGF))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VGF antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VGF antibody was raised against the middle region of VGF

Purification: Affinity purified

Immunogen: VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VGF Blocking Peptide, catalog no. 33R-1490, is also available for use as a blocking control in assays to test for specificity of this VGF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VGF

Target: VGF (VGF Nerve Growth Factor Inducible (VGF))

Alternative Name: VGF (VGF Products)

Synonyms: VGF antibody, Gm1052 antibody, VGF nerve growth factor inducible antibody, VGF antibody, Vgf antibody

Background: This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis