LEFTY1 antibody (N-Term)

Catalog No. ABIN634795

Product Details anti-LEFTY1 Antibody

Target: LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LEFTY1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LEFTY1 antibody was raised against the N terminal of LEFTY1

Purification: Affinity purified

Immunogen: LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LEFTY1 Blocking Peptide, catalog no. 33R-6338, is also available for use as a blocking control in assays to test for specificity of this LEFTY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LEFTY1

Target: LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))

Alternative Name: LEFTY1 (LEFTY1 Products)

Synonyms: atv antibody, cb73 antibody, antivin antibody, ik:tdsubc_2b12 antibody, xx:tdsubc_2b12 antibody, LEFTY1 antibody, AI450052 antibody, Ebaf antibody, Leftb antibody, Stra3 antibody, Tgfb4 antibody, lefty antibody, lefty-1 antibody, RGD1561867 antibody, LEFTB antibody, LEFTYB antibody, lefty1 antibody, signaling molecule lefty1 antibody, left-right determination factor 1 antibody, left right determination factor 1 antibody, lft1 antibody, lefty1 antibody, LOC699924 antibody, LEFTY1 antibody, LOC100408003 antibody, LOC100597378 antibody, Lefty1 antibody

Background: LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.

Molecular Weight: 11 kDa (MW of target protein)