IL-5 antibody

Catalog No. ABIN634806

This anti-IL-5 antibody is a Rabbit Polyclonal antibody detecting IL-5 in WB. Suitable for Human.

Quick Overview for IL-5 antibody (ABIN634806)

Target: IL-5 (IL5) (Interleukin 5 (IL5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL-5 Antibody

Purification: Affinity purified

Immunogen: IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL5 Blocking Peptide, (ABIN940314), is also available for use as a blocking control in assays to test for specificity of this IL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-5

Target: IL-5 (IL5) (Interleukin 5 (IL5))

Alternative Name: IL5

Background: IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, Feeding Behaviour