RNF19A antibody (N-Term)

Catalog No. ABIN634836

Product Details anti-RNF19A Antibody

Target: RNF19A (Ring Finger Protein 19A (RNF19A))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF19A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF19 A antibody was raised against the N terminal of RNF19

Purification: Affinity purified

Immunogen: RNF19 A antibody was raised using the N terminal of RNF19 corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF19A Blocking Peptide, catalog no. 33R-3962, is also available for use as a blocking control in assays to test for specificity of this RNF19A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF19A

Target: RNF19A (Ring Finger Protein 19A (RNF19A))

Alternative Name: RNF19A (RNF19A Products)

Background: RNF19A contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB.

Molecular Weight: 91 kDa (MW of target protein)