PDE3A antibody (phosphodiesterase 3A, cGMP-Inhibited) (N-Term)

Details for Product anti-PDE3A Antibody No. ABIN634852
Antigen
Epitope
N-Term
15
9
5
4
3
3
2
2
1
1
1
1
1
Reactivity
Human
63
31
27
10
7
4
4
3
3
2
1
Host
Rabbit
59
6
3
Clonality
Polyclonal
Conjugate
This PDE3A antibody is un-conjugated
4
3
1
1
1
1
1
1
Application
Western Blotting (WB)
35
26
22
17
16
4
4
3
2
1
1
Options
Immunogen PDE3 A antibody was raised using the N terminal of PDE3 corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
Specificity PDE3 A antibody was raised against the N terminal of PDE3
Purification Affinity purified
Antigen
Alternative Name PDE3A (PDE3A Antibody Abstract)
Background PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).
Molecular Weight 125 kDa (MW of target protein)
Pathways cAMP Metabolic Process
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PDE3A Blocking Peptide, catalog no. 33R-5115, is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (N-Term) antibody (ABIN634852) PDE3A antibody used at 1 ug/ml to detect target protein.