Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PDE3A antibody (phosphodiesterase 3A, cGMP-Inhibited) (N-Term) Primary Antibody

PDE3A Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634852
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    PDE3A
    Binding Specificity
    N-Term
    • 8
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 37
    • 25
    • 22
    • 8
    • 7
    • 4
    • 3
    • 3
    • 2
    • 2
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This PDE3A antibody is un-conjugated
    • 26
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 28
    • 18
    • 14
    • 9
    • 6
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    Specificity
    PDE3 A antibody was raised against the N terminal of PDE3
    Purification
    Affinity purified
    Immunogen
    PDE3 A antibody was raised using the N terminal of PDE3 corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    PDE3A Blocking Peptide, catalog no. 33R-5115, is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    PDE3A
    Alternative Name
    PDE3A (PDE3A Antibody Abstract)
    Synonyms
    PDE3A, Pde3a, si:dkey-48h7.2, A930022O17Rik, C87899, RNPDE3A, CGI-PDE, CGI-PDE A, CGI-PDE-A, phosphodiesterase 3A, phosphodiesterase 3A, cGMP-inhibited, cGMP-inhibited 3',5'-cyclic phosphodiesterase A, phosphodiesterase 3A, cGMP inhibited, PDE3A, Pde3a, LOC100540515, pde3a
    Background
    PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).
    Molecular Weight
    125 kDa (MW of target protein)
    Pathways
    cAMP Metabolic Process
You are here:
help Support