SLC30A8 antibody

Catalog No. ABIN634898

The Rabbit Polyclonal anti-SLC30A8 antibody is suitable to detect SLC30A8 in samples from Human. It has been validated for WB.

Quick Overview for SLC30A8 antibody (ABIN634898)

Target: SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC30A8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC30A8 Antibody

Purification: Affinity purified

Immunogen: SLC30 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC30A8 Blocking Peptide, (ABIN940534), is also available for use as a blocking control in assays to test for specificity of this SLC30A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC30A8

Target: SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))

Alternative Name: SLC30A8

Background: The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Hormone Transport, Carbohydrate Homeostasis, Transition Metal Ion Homeostasis