LFNG antibody (N-Term)

Catalog No. ABIN634905

The Rabbit Polyclonal anti-LFNG antibody (ABIN634905) specifically detects LFNG in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for LFNG antibody (N-Term) (ABIN634905)

Target: LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LFNG antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LFNG Antibody

Binding Specificity: N-Term

Specificity: LFNG antibody was raised against the N terminal of LFNG

Purification: Affinity purified

Immunogen: LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LFNG Blocking Peptide, (ABIN5614447), is also available for use as a blocking control in assays to test for specificity of this LFNG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LFNG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LFNG

Target: LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))

Alternative Name: LFNG

Background: LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Notch Signaling