ALG11 antibody

Catalog No. ABIN634995

This anti-ALG11 antibody is a Rabbit Polyclonal antibody detecting ALG11 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ALG11 antibody (ABIN634995)

Target: ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALG11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALG11 Antibody

Specificity: ALG11 antibody was yeast alpha-12-mannosyltransferase

Purification: Affinity purified

Immunogen: ALG11 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALG11 Blocking Peptide, (ABIN5612018), is also available for use as a blocking control in assays to test for specificity of this ALG11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALG11

Target: ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))

Alternative Name: ALG11

Background: ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase which is localized to the cytosolic side of the endoplasmic reticulum (ER) and catalyzes the transfer of the fourth and fifth mannose residue from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol resulting in the production of Man5GlcNAc2-PP-dolichol. Mutations in this gene are associated with congenital disorder of glycosylation type Ip (CDGIP).

Molecular Weight: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome