SLC25A21 antibody

Catalog No. ABIN635065

This Rabbit Polyclonal antibody specifically detects SLC25A21 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for SLC25A21 antibody (ABIN635065)

Target: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A21 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A21 Antibody

Purification: Affinity purified

Immunogen: SLC25 A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A21 Blocking Peptide, (ABIN938523), is also available for use as a blocking control in assays to test for specificity of this SLC25A21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A21

Target: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Alternative Name: SLC25A21

Background: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome