SLC46A1 antibody

Catalog No. ABIN635109

Product Details anti-SLC46A1 Antibody

Target: SLC46A1 (Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC46A1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC46 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC46A1 Blocking Peptide, catalog no. 33R-5921, is also available for use as a blocking control in assays to test for specificity of this SLC46A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC46A1

Target: SLC46A1 (Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1))

Alternative Name: SLC46A1 (SLC46A1 Products)

Synonyms: G21 antibody, HCP1 antibody, PCFT antibody, RGD1309472 antibody, TRPE antibody, 1110002C08Rik antibody, D11Ertd18e antibody, Pcft antibody, solute carrier family 46 member 1 antibody, solute carrier family 46 (folate transporter), member 1 antibody, solute carrier family 46, member 1 antibody, SLC46A1 antibody, slc46a1 antibody, Slc46a1 antibody

Background: This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes optimally in acidic pH environments.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Dicarboxylic Acid Transport