INSIG1 antibody (Middle Region)

Catalog No. ABIN635167

This Rabbit Polyclonal antibody specifically detects INSIG1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for INSIG1 antibody (Middle Region) (ABIN635167)

Target: INSIG1 (Insulin Induced Gene 1 (INSIG1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INSIG1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-INSIG1 Antibody

Binding Specificity: Middle Region

Specificity: INSIG1 antibody was raised against the middle region of INSIG1

Purification: Affinity purified

Immunogen: INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INSIG1 Blocking Peptide, (ABIN935998), is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INSIG1

Target: INSIG1 (Insulin Induced Gene 1 (INSIG1))

Alternative Name: INSIG1

Background: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling