Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

INSIG1 antibody (Insulin Induced Gene 1) (Middle Region) Primary Antibody

INSIG1 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635167
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    INSIG1
    Binding Specificity
    Middle Region
    • 8
    • 6
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human, Mouse, Rat
    • 28
    • 8
    • 7
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This INSIG1 antibody is un-conjugated
    • 16
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    Application
    Western Blotting (WB)
    • 26
    • 18
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Specificity
    INSIG1 antibody was raised against the middle region of INSIG1
    Purification
    Affinity purified
    Immunogen
    INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    INSIG1 Blocking Peptide, catalog no. 33R-10042, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    INSIG1
    Alternative Name
    INSIG1 (INSIG1 Antibody Abstract)
    Synonyms
    cl-6, cl6, CL-6, CL6, fb55a03, fi35b10, wu:fb55a03, wu:fi35b10, zgc:55439, 1810013C12Rik, Insig-1, INSIG-1, insulin induced gene 1, insulin induced gene 1 L homeolog, INSIG1, insig1, insig1.L, Insig1
    Background
    Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.
    Molecular Weight
    25 kDa (MW of target protein)
    Pathways
    ER-Nucleus Signaling
You are here:
help Support