INSIG1 antibody (Insulin Induced Gene 1) (Middle Region)

Details for Product anti-INSIG1 Antibody No. ABIN635167
Antigen
Epitope
Middle Region
9
8
8
4
2
2
2
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
40
11
11
7
4
4
4
4
3
3
3
3
2
2
2
1
1
Host
Rabbit
44
Clonality
Polyclonal
Conjugate
This INSIG1 antibody is un-conjugated
3
2
2
2
2
2
Application
Western Blotting (WB)
41
19
7
3
3
2
1
1
1
Options
Immunogen INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
Specificity INSIG1 antibody was raised against the middle region of INSIG1
Purification Affinity purified
Antigen
Alternative Name INSIG1 (INSIG1 Antibody Abstract)
Background Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.
Molecular Weight 25 kDa (MW of target protein)
Pathways ER-Nucleus Signaling
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

INSIG1 Blocking Peptide, catalog no. 33R-10042, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Insulin Induced Gene 1 (INSIG1) (Middle Region) antibody (ABIN635167) INSIG1 antibody used at 1 ug/ml to detect target protein.