MUC1 antibody (Middle Region)
-
- Target See all MUC1 Antibodies
- MUC1 (Mucin 1 (MUC1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MUC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MUC1 antibody was raised against the middle region of MUC1
- Purification
- Affinity purified
- Immunogen
- MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM
- Top Product
- Discover our top product MUC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MUC1 Blocking Peptide, catalog no. 33R-1532, is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUC1 (Mucin 1 (MUC1))
- Alternative Name
- MUC1 (MUC1 Products)
- Background
- MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
- Molecular Weight
- 14 kDa (MW of target protein)
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-