DLG3 antibody

Catalog No. ABIN635177

Product Details anti-DLG3 Antibody

Target: DLG3 (Discs, Large Homolog 3 (DLG3))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLG3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLG3 Blocking Peptide, catalog no. 33R-3722, is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLG3

Target: DLG3 (Discs, Large Homolog 3 (DLG3))

Alternative Name: DLG3 (DLG3 Products)

Synonyms: MRX antibody, MRX90 antibody, NEDLG antibody, SAP102 antibody, XLMR antibody, DLG3 antibody, fa66c08 antibody, fa66e02 antibody, fd02c12 antibody, fu95c12 antibody, im:7138640 antibody, si:ch211-276g21.1 antibody, wu:fa66c08 antibody, wu:fa66e02 antibody, wu:fd02c12 antibody, wu:fu95c12 antibody, Dlgh3 antibody, mKIAA1232 antibody, MPP3 antibody, 6430514B01 antibody, CSG18 antibody, Dlg3 antibody, Dusp3 antibody, discs large MAGUK scaffold protein 3 antibody, membrane palmitoylated protein 3 antibody, discs, large homolog 3 (Drosophila) antibody, membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) antibody, DLG3 antibody, MPP3 antibody, dlg3 antibody, Dlg3 antibody, Mpp3 antibody

Background: DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).

Molecular Weight: 58 kDa (MW of target protein)