GCS1 antibody (N-Term)

Catalog No. ABIN635202

The Rabbit Polyclonal anti-GCS1 antibody (ABIN635202) specifically detects GCS1 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for GCS1 antibody (N-Term) (ABIN635202)

Target: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GCS1 Antibody

Binding Specificity: N-Term

Specificity: GCS1 antibody was raised against the N terminal of GCS1

Purification: Affinity purified

Immunogen: GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCS1 Blocking Peptide, (ABIN938872), is also available for use as a blocking control in assays to test for specificity of this GCS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCS1

Target: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Alternative Name: GCS1

Background: GCS1 is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum.

Molecular Weight: 92 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome