Tetraspanin 17 antibody (Middle Region)

Catalog No. ABIN635253

The Rabbit Polyclonal anti-Tetraspanin 17 antibody (ABIN635253) specifically detects Tetraspanin 17 in WB. The antibody is reactive with Human samples.

Quick Overview for Tetraspanin 17 antibody (Middle Region) (ABIN635253)

Target: Tetraspanin 17 (TSPAN17)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tetraspanin 17 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Tetraspanin 17 Antibody

Binding Specificity: Middle Region

Specificity: Tetraspanin 17 antibody was raised against the middle region of TSPAN17

Purification: Affinity purified

Immunogen: Tetraspanin 17 antibody was raised using the middle region of TSPAN17 corresponding to a region with amino acids ELATGILAFVFKDWIRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 17 Blocking Peptide, (ABIN937915), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tetraspanin 17

Target: Tetraspanin 17 (TSPAN17)

Alternative Name: Tetraspanin 17

Background: The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 37 kDa (MW of target protein)