PGRMC1 antibody (N-Term)

Catalog No. ABIN635310

Product Details anti-PGRMC1 Antibody

Target: PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGRMC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PGRMC1 antibody was raised against the N terminal of PGRMC1

Purification: Affinity purified

Immunogen: PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGRMC1 Blocking Peptide, catalog no. 33R-5590, is also available for use as a blocking control in assays to test for specificity of this PGRMC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGRMC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGRMC1

Target: PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))

Alternative Name: PGRMC1 (PGRMC1 Products)

Synonyms: MGC89150 antibody, wu:fa94d03 antibody, zgc:103577 antibody, DKFZp469D0815 antibody, HPR6.6 antibody, MPR antibody, AA415812 antibody, PPMR antibody, Vema antibody, 25-Dx antibody, 25Dx antibody, VEMA antibody, progesterone receptor membrane component 1 antibody, pgrmc1 antibody, PGRMC1 antibody, Pgrmc1 antibody

Background: Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.

Molecular Weight: 22 kDa (MW of target protein)