PLD3 antibody (N-Term)

Catalog No. ABIN635404

Product Details anti-PLD3 Antibody

Target: PLD3 (Phospholipase D family member 3 (PLD3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLD3 antibody was raised against the N terminal of PLD3

Purification: Affinity purified

Immunogen: PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLD3 Blocking Peptide, catalog no. 33R-10033, is also available for use as a blocking control in assays to test for specificity of this PLD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLD3

Target: PLD3 (Phospholipase D family member 3 (PLD3))

Alternative Name: PLD3 (PLD3 Products)

Synonyms: DDBDRAFT_0204850 antibody, DDBDRAFT_0231505 antibody, DDB_0204850 antibody, DDB_0231505 antibody, DDBDRAFT_0187542 antibody, DDBDRAFT_0220113 antibody, DDB_0187542 antibody, DDB_0220113 antibody, HU-K4 antibody, HUK4 antibody, Sam-9 antibody, phospholipase D3 antibody, phospholipase D family member 3 antibody, phospholipase D family, member 3 antibody, CpipJ_CPIJ017227 antibody, pldZ antibody, pldY antibody, DICPUDRAFT_30308 antibody, PLD3 antibody, Pld3 antibody

Background: PLD3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome