INSIG2 antibody (N-Term)

Catalog No. ABIN635502

This anti-INSIG2 antibody is a Rabbit Polyclonal antibody detecting INSIG2 in WB. Suitable for Human.

Quick Overview for INSIG2 antibody (N-Term) (ABIN635502)

Target: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INSIG2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-INSIG2 Antibody

Binding Specificity: N-Term

Specificity: INSIG2 antibody was raised against the N terminal of INSIG2

Purification: Affinity purified

Immunogen: INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INSIG2 Blocking Peptide, (ABIN5614202), is also available for use as a blocking control in assays to test for specificity of this INSIG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INSIG2

Target: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Alternative Name: INSIG2

Background: INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling