INSIG2 antibody (N-Term)

Catalog No. ABIN635502

Product Details anti-INSIG2 Antibody

Target: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INSIG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: INSIG2 antibody was raised against the N terminal of INSIG2

Purification: Affinity purified

Immunogen: INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INSIG2 Blocking Peptide, catalog no. 33R-5639, is also available for use as a blocking control in assays to test for specificity of this INSIG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INSIG2

Target: INSIG2 (Insulin Induced Gene 2 (INSIG2))

Alternative Name: INSIG2 (INSIG2 Products)

Synonyms: MGC82156 antibody, INSIG-2 antibody, 2900053I11Rik antibody, C730043J18Rik antibody, Insig-2 antibody, insulin induced gene 2 antibody, insulin induced gene 2 L homeolog antibody, insig2 antibody, insig2.L antibody, INSIG2 antibody, Insig2 antibody

Background: INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling