MPG antibody (Middle Region)

Catalog No. ABIN635545

This Rabbit Polyclonal antibody specifically detects MPG in WB. It exhibits reactivity toward Human.

Quick Overview for MPG antibody (Middle Region) (ABIN635545)

Target: MPG (N-Methylpurine-DNA Glycosylase (MPG))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPG antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MPG Antibody

Binding Specificity: Middle Region

Specificity: MPG antibody was raised against the middle region of MPG

Purification: Affinity purified

Immunogen: MPG antibody was raised using the middle region of MPG corresponding to a region with amino acids QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPG Blocking Peptide, (ABIN5614822), is also available for use as a blocking control in assays to test for specificity of this MPG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPG

Target: MPG (N-Methylpurine-DNA Glycosylase (MPG))

Alternative Name: MPG

Background: MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: DNA Damage Repair